q65hx7, q65hx7, q65hx7, q65hx7, q65hx7

Local World

Result : 'q65hx7'

KEGG B.licheniformis_DSM13: BLi02462

UniProt: Q65HX7: LinkDB: Position: complement(2398878..2399612) AA seq: 244 aa MERLQKVIAHAGIASRRKAEELIKEGRVTVNGKTVRELGVKVSSSDRIEVNGVQLESEEP ...

www.genome.ad.jp/dbget-bin/www_bget?bld+BLi02462
· " align=left id=vr> KEGG B.licheniformis_DSM13: BLi02462
UniProt: Q65HX7: LinkDB: Position: complement(2398878..2399612) AA seq: 244 aa MERLQKVIAHAGIASRRKAEELIKEGRVTVNGKTVRELGVKVSSSDRIEVNGVQLESEEP ...
- www.genome.ad.jp/dbget-bin/www_bget?bld+BLi02462
- · " class=vb>
  UniProt: Q65HX7: LinkDB: Position: complement(2398878..2399612) AA seq: 244 aa MERLQKVIAHAGIASRRKAEELIKEGRVTVNGKTVRELGVKVSSSDRIEVNGVQLESEEP ...

BLAST Search Results

... 32 UniRef100_UPI000178B893 pseudouridine synthase n=1 Tax=Chloroher... 140 8e-32 UniRef100_A4J3M3 Ribosomal large subunit pseudouridine synthase ... 140 1e-31 UniRef100_Q65HX7 ...

bmb.med.miami.edu/blast/prerun/EG11921.html
· " align=left id=vr> BLAST Search Results
... 32 UniRef100_UPI000178B893 pseudouridine synthase n=1 Tax=Chloroher... 140 8e-32 UniRef100_A4J3M3 Ribosomal large subunit pseudouridine synthase ... 140 1e-31 UniRef100_Q65HX7 ...
- bmb.med.miami.edu/blast/prerun/EG11921.html
- · " class=vb>
  ... 32 UniRef100_UPI000178B893 pseudouridine synthase n=1 Tax=Chloroher... 140 8e-32 UniRef100_A4J3M3 Ribosomal large subunit pseudouridine synthase ... 140 1e-31 UniRef100_Q65HX7 ...

SDR results

RNA pseudouridylate synthase (PF00849.12) Calculated using 2254 sequences. Use the following drop-down menus to select a guide protein to show with a subset of the multiple ...

paradox.harvard.edu/sdr/families/PF00849.12/PF00849.12_main.html
· " align=left id=vr> SDR results
RNA pseudouridylate synthase (PF00849.12) Calculated using 2254 sequences. Use the following drop-down menus to select a guide protein to show with a subset of the multiple ...
- paradox.harvard.edu/sdr/families/PF00849.12/PF00849.12_main.html
- · " class=vb>
  RNA pseudouridylate synthase (PF00849.12) Calculated using 2254 sequences. Use the following drop-down menus to select a guide protein to show with a subset of the multiple ...

UE-

UE-COG - UniRef-Enriched COG Database ...

www.biotec.icb.ufmg.br/uecog/uecog_list.php?cog_num=COG1187&categoria=J
· " align=left id=vr> UE-
UE-COG - UniRef-Enriched COG Database ...
- www.biotec.icb.ufmg.br/uecog/uecog_list.php?cog_num=COG1187&categoria=J
- · " class=vb>
  UE-COG - UniRef-Enriched COG Database ...

Entry Page

... ac q97i05 #=gs y1464_aquae/64-198 ac o67444 #=gs q9kcj5_bachd/62-196 ac q9kcj5 #=gs q5wgy9_bacsk/62-196 ac q5wgy9 #=gs q62tc6_bacld/77-212 ac q62tc6 #=gs q65hx7 ...

www.proteomics.leeds.ac.uk/srs71bin/cgi-bin/wgetz?-id+4F_8r1XIEMZ+[pfama-AccNumber:PF00849...
· " align=left id=vr> Entry Page
... ac q97i05 #=gs y1464_aquae/64-198 ac o67444 #=gs q9kcj5_bachd/62-196 ac q9kcj5 #=gs q5wgy9_bacsk/62-196 ac q5wgy9 #=gs q62tc6_bacld/77-212 ac q62tc6 #=gs q65hx7 ...
- www.proteomics.leeds.ac.uk/srs71bin/cgi-bin/wgetz?-id+4F_8r1XIEMZ+[pfama-AccNumber:PF00849...
- · " class=vb>
  ... ac q97i05 #=gs y1464_aquae/64-198 ac o67444 #=gs q9kcj5_bachd/62-196 ac q9kcj5 #=gs q5wgy9_bacsk/62-196 ac q5wgy9 #=gs q62tc6_bacld/77-212 ac q62tc6 #=gs q65hx7 ...

hub.gersteinlab.org

GO GO:0006364. Links. Gene Ontology; Equivalent or Related Ids. UniProtKB/Swiss-Prot Acc. UniProtKB/Swiss-Prot Acc Q8P7U8 (Functional Annotation ( EVIDENCE:

hub.gersteinlab.org/id/GO:0006364
· " align=left id=vr> hub.gersteinlab.org
GO GO:0006364. Links. Gene Ontology; Equivalent or Related Ids. UniProtKB/Swiss-Prot Acc. UniProtKB/Swiss-Prot Acc Q8P7U8 (Functional Annotation ( EVIDENCE:
- hub.gersteinlab.org/id/GO:0006364
- · " class=vb>
  GO GO:0006364. Links. Gene Ontology; Equivalent or Related Ids. UniProtKB/Swiss-Prot Acc. UniProtKB/Swiss-Prot Acc Q8P7U8 (Functional Annotation ( EVIDENCE:

nsps survey site, ungerinterface, care cleanser oily skin, mhighlancomputersvideo_games, abortion family greenville,greenville planned planning, register, counseling-the-adolescent-individual-family-and-school-intervention, create your own free online surveys, x5, american history a survey 11 e, online survey sites that pay in cash only, myspace surveys about me, 上杉まつりの様子, hout, mail telephone online and personal intervew survey methods, bulk, free fun myspace profile surveys, sneakers, info-http-www-livejournal-com-community-surveys-1336373-html, aerial survey photos in cyprus, cătălin, market research companies pay cash surveys, skincare-black-woman, 프리스톤테일2, swapnet, gregorg, deau, business-market-report-research-service, xanga survey and quiz, duecom, companies that pay for online surveys, alan-american-history-a-survey-online-learning-cen, online-survey-taker, fun surveys and quizzes blog, myspace survey bulletin, Ð�Ð°, afajournalorg, benefits of a reading interest survey, cannellorgblog, oseus, convect, get paid to take online survey paid survey surveyzip.com, colorado family lodging reunion, is the get paid to do online surveys legitimate, affordable family dental care, caverns, colorado-family-law, lower shabelle flood aerial survey, survey questions for myspace prifiles, detoxify your body, find info for stock market investor research guide on, family crest jewelry, bathhouse, student interest learning survey, food-lab-tech-salary-survey, Michael, graduated-student-problems-survey-with-their-new-jobs, best survey paying sites online, games-video-games-sports-pro-wrestling, mod0, itasca county soil survey, free uk paid survey, 日, dentures, abc-family-photo, cheap-family-cruises, used survey equipment florida, trackingpublicideescom, spain, surveys career, suggest your site survey jobs, memling, tung, quizzes and surveys for my myspace page, kafka, training-class-survey-example, surveys teen, customer-satisfaction-surveys-in-education, consumer satisfaction surveys, vst3, affordable-health-insurance-for-low-income-family, free paid survey sat home, reputable paid surveys, paid-surveys-ontario, survey-research-method, eighth, earn money paid online surveys, home-food-safety-survey, child, quiz-and-survey-sites, free list online paid survey, get-paid-filling-out-surveys, archenemys, take surveys email survey free online paid survey, a christian survey of world history rousas john rushdoony, unifrom, market-research-companies-that-pay-cash-for-survey, metasearchcom, harmonicflowcom, msaccess survey form,

LOCAL WORLD

Local World

Local World