q16av0, q16av0, q16av0, q16av0, q16av0

Local World

Result : 'q16av0'

Pfam: Protein: Q16AV0_ROSDO (Q16AV0)

Pfam is a large collection of protein families, represented by multiple sequence alignments and hidden Markov models (HMMs)

pfam.sanger.ac.uk/protein?acc=Q16AV0
· " align=left id=vr> Pfam: Protein: Q16AV0_ROSDO (Q16AV0)
Pfam is a large collection of protein families, represented by multiple sequence alignments and hidden Markov models (HMMs)
- pfam.sanger.ac.uk/protein?acc=Q16AV0
- · " class=vb>
  Pfam is a large collection of protein families, represented by multiple sequence alignments and hidden Markov models (HMMs)

UniProtKB/Swiss-Prot entry Q16AV0 [SYK_ROSDO] Lysyl-tRNA synthetase

Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms. Distributed under the Creative Commons Attribution-NoDerivs License.

www.expasy.org/uniprot/Q16AV0
· " align=left id=vr> UniProtKB/Swiss-Prot entry Q16AV0 [SYK_ROSDO] Lysyl-tRNA synthetase
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms. Distributed under the Creative Commons Attribution-NoDerivs License.
- www.expasy.org/uniprot/Q16AV0
- · " class=vb>
  Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms. Distributed under the Creative Commons Attribution-NoDerivs License.

Phylogenetic tree of the gene family HBG033056 in database HOGENOM

... Q16AV0 ... Note: Entries which are not found in UniprotKB are tagged with a # character.

pbil.univ-lyon1.fr/cgi-bin/acnuc-ac2tree?query=Q16AV0&db=HOGENOM
· " align=left id=vr> Phylogenetic tree of the gene family HBG033056 in database HOGENOM
... Q16AV0 ... Note: Entries which are not found in UniprotKB are tagged with a # character.
- pbil.univ-lyon1.fr/cgi-bin/acnuc-ac2tree?query=Q16AV0&db=HOGENOM
- · " class=vb>
  ... Q16AV0 ... Note: Entries which are not found in UniprotKB are tagged with a # character.

ENZYME entry 6.1.1.6

q68x04, syk_ricty; a7nfc6, syk_roscs; q16av0, syk_rosdo; a5upg6, syk_ross1; a9mri4, syk_salar; q57k76, syk_salch; q5pl30, syk_salpa; a9n3l6, syk_salpb; a8gip4, syk_serp5;

www.expasy.org/enzyme/6.1.1.6
· " align=left id=vr> ENZYME entry 6.1.1.6
q68x04, syk_ricty; a7nfc6, syk_roscs; q16av0, syk_rosdo; a5upg6, syk_ross1; a9mri4, syk_salar; q57k76, syk_salch; q5pl30, syk_salpa; a9n3l6, syk_salpb; a8gip4, syk_serp5;
- www.expasy.org/enzyme/6.1.1.6
- · " class=vb>
  q68x04, syk_ricty; a7nfc6, syk_roscs; q16av0, syk_rosdo; a5upg6, syk_ross1; a9mri4, syk_salar; q57k76, syk_salch; q5pl30, syk_salpa; a9n3l6, syk_salpb; a8gip4, syk_serp5;

KEGG R.denitrificans: RD1_1246

uniprot: q16av0: linkdb: position: 1208693..1210276 aa seq: 527 aa msdtrtaamtskawpfeearrvlkryeknppekgyvlfetgygpsglphigtfgevarts mvmrafqeisdiptrlicfsddldgmrkvpgnvpnpdaltehlqrpltsvpdpfgthasf

www.genome.ad.jp/dbget-bin/www_bget?rde+RD1_1246
· " align=left id=vr> KEGG R.denitrificans: RD1_1246
uniprot: q16av0: linkdb: position: 1208693..1210276 aa seq: 527 aa msdtrtaamtskawpfeearrvlkryeknppekgyvlfetgygpsglphigtfgevarts mvmrafqeisdiptrlicfsddldgmrkvpgnvpnpdaltehlqrpltsvpdpfgthasf
- www.genome.ad.jp/dbget-bin/www_bget?rde+RD1_1246
- · " class=vb>
  uniprot: q16av0: linkdb: position: 1208693..1210276 aa seq: 527 aa msdtrtaamtskawpfeearrvlkryeknppekgyvlfetgygpsglphigtfgevarts mvmrafqeisdiptrlicfsddldgmrkvpgnvpnpdaltehlqrpltsvpdpfgthasf

www.orenza.u-psud.fr

Common name: Lysine--tRNA ligase: Systematic name: L-lysine:tRNA(Lys) ligase (AMP-forming) ... Q0T9N4,SYK3_ECOL5_] [Q0TMI7,SYK_CLOP1__] [Q12JH2,SYK_SHEDO__] [Q15046,SYK_HUMAN__] [Q16AV0 ...

www.orenza.u-psud.fr/query_by_ec.php?EC_number=EC%206.1.1.6
· " align=left id=vr> www.orenza.u-psud.fr
Common name: Lysine--tRNA ligase: Systematic name: L-lysine:tRNA(Lys) ligase (AMP-forming) ... Q0T9N4,SYK3_ECOL5_] [Q0TMI7,SYK_CLOP1__] [Q12JH2,SYK_SHEDO__] [Q15046,SYK_HUMAN__] [Q16AV0 ...
- www.orenza.u-psud.fr/query_by_ec.php?EC_number=EC%206.1.1.6
- · " class=vb>
  Common name: Lysine--tRNA ligase: Systematic name: L-lysine:tRNA(Lys) ligase (AMP-forming) ... Q0T9N4,SYK3_ECOL5_] [Q0TMI7,SYK_CLOP1__] [Q12JH2,SYK_SHEDO__] [Q15046,SYK_HUMAN__] [Q16AV0 ...

PROSITE - Entry: PS00178

Search ...

kr.expasy.org/prosite/PS00178
· " align=left id=vr> PROSITE - Entry: PS00178
Search ...
- kr.expasy.org/prosite/PS00178
- · " class=vb>
  Search ...

bioinformatics.cancerresearchuk.org

q16av0_rosdo/12-388:0.06698):0.01177, q0fph6_9rhob/12-388:0.07875):0.00691, (q2cb01_9rhob/12-388:0.07692, q28l78_jansc/12-388:0.07692):0.00873):0.01042):

bioinformatics.cancerresearchuk.org/pfam/family/tree/download?alnType=full&acc=PF01921
· " align=left id=vr> bioinformatics.cancerresearchuk.org
q16av0_rosdo/12-388:0.06698):0.01177, q0fph6_9rhob/12-388:0.07875):0.00691, (q2cb01_9rhob/12-388:0.07692, q28l78_jansc/12-388:0.07692):0.00873):0.01042):
- bioinformatics.cancerresearchuk.org/pfam/family/tree/download?alnType=full&acc=PF01921
- · " class=vb>
  q16av0_rosdo/12-388:0.06698):0.01177, q0fph6_9rhob/12-388:0.07875):0.00691, (q2cb01_9rhob/12-388:0.07692, q28l78_jansc/12-388:0.07692):0.00873):0.01042):

reception-customer-surveys, ocgs, automobile research surveys that pay, recommend, biglobe, cruise-family-photo, families activity, family-reunion-welcome-letter, get-paid-pounds-for-taking-online-surveys, family photo genealogy, ordnung, get paid to take survey free list, travelheavy, family-history-search, seminarscom, aven, healthy food an irreverent guide to understanding nutrition and feeding your family well, marketing salary survey results, kirsty, myspace codes polls quizes surveys, ble, andy, construction equipment customer satisfaction survey, tell me about population surveys od different races, free money surveys demo product survey online surveyblog.info, la county office land survey report, land-loss-survey-instrument, soil survey of texas, kern family health care, salary surveys risk, Consumer Credit Counseling, fun surveys future, flyleaf, allegheny county family court, earn take online survey faq join, entertainmentweddings, online paid paid survey, quick cash loans, take free survey and get paid cash online paid review, survey-methodology-research, get-paid-money-for-surveys, groupcojp, market-research-focus-jobs-in-melb, internetbased-employee-surveys, car-survey-to-figure-out-the-best-for-me, alta ascm land survey title, rock-music-survey-questionnaire, myspace-survey-about-your-friends-bzoink, mckay, survey hot jobs in california, create online survey survey software online form web, 공�, idaho-surveys-that-pay, Donna, www.officemax.con store survey, create a vehicle survey form, market-research-specialists, artjankauskas, people-who-survey-land-in-scioto-county-ohio, my space tell me about yourself surveys, myspace create your own survey, starship, 뉴킹제임스, wwwezinfocentercom, free ways to make money online, arms-coat-family-ferguson, how-much-stupid-are-you-fun-survey, where to conduct focus groups in sf, GERALD, 네트워트, my-space-surveys-and-bulletins, free to join paying online surveys free money surveys surveyblog.info, traceable, short and fun myspace surveys, american family entertainment, Robert K, worker�™s, download-the-captain-and-the-kid-mp3-album, weird-myspace-surveys, surveys-of-land-in-morgan-county-hooksburg-ohio, telephone interview survey leads mlm home based business, family-web-site-design, online-survey-results, attorney de dover family law, evenimente, surveys-about-jock-straps, cmes, races, on-line-survey-paid, croatian ordnance survey map, georgetown-county-land-surveys, researchbuycom, best paid survey program, american-community-survey-book-surveys, poszedł, student-interest-surveys-high-school-students, spongeabout, free-surveys-that-earn-money, krms, presto®,

LOCAL WORLD

Local World

Local World